PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01450.1_g00013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 419aa    MW: 47546.3 Da    PI: 7.0482
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01450.1_g00013.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.31.3e-52161421128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              l pGfrFhPtdeelv++yLk+kv++++l++ e i+++diyk++PwdLp k++++ekewyf+++rd+ky++++r+nr+t +g+Wkat
  Rsa1.0_01450.1_g00013.1  16 LLPGFRFHPTDEELVSFYLKRKVQHNPLSI-ELIRQLDIYKYDPWDLP-KFATGEKEWYFYCPRDRKYRNSSRPNRVTGAGFWKAT 99 
                              579***************************.89***************.777899******************************* PP

                      NAM  87 gkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g+d++++s+ +++ +glkk+Lvfykgra kg+ktdW+mhe+r+
  Rsa1.0_01450.1_g00013.1 100 GTDRPIYSSeGNKCIGLKKSLVFYKGRAAKGVKTDWMMHEFRM 142
                              ********956667***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.41E-5812174IPR003441NAC domain
PROSITE profilePS5100557.31616174IPR003441NAC domain
PfamPF023651.8E-2518142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0045770Biological Processpositive regulation of asymmetric cell division
GO:0048103Biological Processsomatic stem cell division
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MGERNNDGDQ KMEEVLLPGF RFHPTDEELV SFYLKRKVQH NPLSIELIRQ LDIYKYDPWD  60
LPKFATGEKE WYFYCPRDRK YRNSSRPNRV TGAGFWKATG TDRPIYSSEG NKCIGLKKSL  120
VFYKGRAAKG VKTDWMMHEF RMPSLSEPSP SSKRFFDSPV SPNDSWAICR IFKKTNTTTL  180
RALSHSFVSS LPSETSIDTL SSDQKLSNTS HFSSEKILKT SSHFQSHHEH MKSTPKTSTS  240
PTSHVATINP FSYLDFTSYE KTTNVFNPVS CLEQQYLTNL LLATQETQPQ FPRLAASNEL  300
PSFLLNMPSS DSAFLGECTS QIDLSVMLAQ EQCPALVSLP QEYQGKGLEG NVEIKNMCGF  360
NEDHHNHCGT LRFSDIGSPI EENHGHRYQD VKYNMALLES YYSSLSSSSG DLPTCFSTT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-541617817169NAC domain-containing protein 19
4dul_A3e-541617817169NAC domain-containing protein 19
1ut7_B3e-541617817169NO APICAL MERISTEM PROTEIN
1ut7_A3e-541617817169NO APICAL MERISTEM PROTEIN
1ut4_B3e-541617817169NO APICAL MERISTEM PROTEIN
1ut4_A3e-541617817169NO APICAL MERISTEM PROTEIN
3swp_D4e-541617820172NAC domain-containing protein 19
3swp_C4e-541617820172NAC domain-containing protein 19
3swp_B4e-541617820172NAC domain-containing protein 19
3swp_A4e-541617820172NAC domain-containing protein 19
3swm_D4e-541617820172NAC domain-containing protein 19
3swm_C4e-541617820172NAC domain-containing protein 19
3swm_B4e-541617820172NAC domain-containing protein 19
3swm_A4e-541617820172NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893850.0AC189385.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB052E19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013603948.10.0PREDICTED: protein FEZ-like
RefseqXP_013675490.10.0PREDICTED: protein FEZ-like
SwissprotQ9ZVH00.0FEZ_ARATH; Protein FEZ
TrEMBLA0A078JFQ00.0A0A078JFQ0_BRANA; BnaCnng46350D protein
TrEMBLA0A0D3DR820.0A0A0D3DR82_BRAOL; Uncharacterized protein
STRINGBra016294.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30628200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.10.0NAC family protein